Dengue virus is caused by one of four closely related virus serotypes of the genus Flavivirus, family Flaviviridae. Each serotype is sufficiently different from the other such that there is no cross-protection and epidemics caused by multiple serotypes (hyperendemicity) can occur. In cell culture experiments and in mice Morpholino antisense oligos have shown specific activity against dengue virus.
The E. coli-derived recombinant 28 kDa protein is a genetically engineered peptide which is from dengue type-3 envelope. This region also contains a common antigen for dengue virus types 1, 2 and 4. The sequence is from dengue virus type 3 strain C0360/94, genebank access code is AY923865. The protein is purified by proprietary chromatographic technique. Purity is >95% pure as determined by 10% PAGE followed by coomassie staining. Formulation is 50 mM sodium chloride-phosphorous buffer, pH-7.5.
Sequence:
GSLATLRKLCIEGKITNITTDSRCPTQGEAVLPEEQDQNYVCKHTYVDRGWGNGCGLFGKGS
LVTCAKFQCLEPIEGKVVQYENLKYTVIITVHTGDQHQVGNETQGVTAEITPQASTTEAILP
EYGTLGLECSPRTGLDFNEMILLTMKNKAWMVHRQWFFDLPLPWTSGATTETPTWNRKELLV
TFKNAHAKKQE
To view protocol(s) for this and other products please visit: www.ATSbio.com/support/protocols