Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. It also helps restore the body’s salt and water balance and improves heart function.
B-type Natriuretic Peptide (BNP) human recombinant produced in E. coli is a single, non-glycosylated, polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. It is purified by proprietary chromatographic techniques. Purity is greater than 95.0% as determined by RP-HPLC and SDS-Page. BNP was lyophilized from 0.4 ml PBS buffer containing 20 mM phosphate buffer and 0.6 mM sodium chloride.
Amino acid sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH